Description

VIP Biovantage Labs Research Peptide

VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide studied for its roles in smooth muscle relaxation, immunomodulation, circadian rhythm regulation, and anti-inflammatory signalling across gastrointestinal, neurological, and pulmonary research models. Biovantage Labs supplies VIP at 99+% purity, HPLC/MS verified. Domestically fulfilled from Canada. Not for human consumption. Biovantage Labs provides this compound at 99+% purity, confirmed by batch-specific HPLC and Mass Spectrometry analysis, as a lyophilized compound for use in controlled laboratory settings.

Molecular Profile and Chemical Specifications

Specification	Detail
Molecular Formula	C147H237N43O43S
Molecular Weight	3,325.8 Da
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 AA)
Purity	≥99+% (HPLC/MS verified)
Physical Form	Lyophilized white powder
CAS Number	40077-57-4

 

Primary Research Mechanisms

Immune tolerance research examining T-regulatory cell induction alongside innate immune modulation frequently positions VIP alongside Thymosin Alpha-1, both studied for their capacity to shift immune polarisation toward tolerogenic phenotypes through distinct receptor systems (VPAC for VIP; TLR2/TLR9 for Thymosin Alpha-1).

VPAC1/VPAC2 Receptor Activation and cAMP Signalling

VIP signals primarily through VPAC1 and VPAC2 receptors, both Gs-coupled GPCRs that elevate intracellular cAMP. Research examines the tissue-specific consequences of differential VPAC receptor expression in smooth muscle, immune cell, and neurological research contexts.

T-Regulatory Cell Induction and Immune Tolerance Research

VIP is studied for its capacity to promote regulatory T-cell (Treg) differentiation and suppress Th1/Th17 inflammatory responses. Research in autoimmune and inflammatory disease models examines VIP as a tool for modulating immune polarisation.

Circadian Clock Gene Modulation

VIP is expressed in the suprachiasmatic nucleus (SCN) and plays a central role in synchronizing circadian rhythms across the body’s peripheral clocks. Research examines VIP-VPAC2 signalling as a primary mechanism of SCN pacemaker coordination.

Circadian biology research examining neuropeptide contributions to clock gene regulation may also reference DSIP (Delta Sleep-Inducing Peptide), studied for HPA axis modulation and sleep architecture effects that intersect with the suprachiasmatic nucleus synchronization functions examined in VIP/VPAC2 circadian research.

Reconstitution Protocol

• Reconstitute using sterile bacteriostatic water or 0.9% sodium chloride solution
• Introduce diluent slowly along the interior vial wall. Do not inject directly onto the lyophilized cake
• Swirl gently until fully dissolved. Do not shake or vortex
• Allow the vial to equilibrate to room temperature before opening to prevent condensation

Storage and Stability

Storage Condition	State	Estimated Stability
-20°C to -80°C	Lyophilized	24+ months
2°C to 8°C	Lyophilized	12 months
Room temperature (20°C)	Lyophilized	3 months
2°C to 8°C	Reconstituted	7 to 14 days

 

Store in a desiccated environment away from UV exposure. Avoid repeated freeze-thaw cycles, which degrade peptide chain integrity over time.

VIP Research FAQ

Q: What distinguishes VIP from other neuropeptides with anti-inflammatory properties?

A: VIP’s breadth of research applications spanning the nervous, immune, and endocrine systems via VPAC1 and VPAC2 receptors is unusual among neuropeptides. Its simultaneous roles in circadian regulation, immune tolerance, and smooth muscle function make it a uniquely pleiotropic research tool compared to peptides with narrower signalling profiles.

Q: Is VIP for human use?

A: No. VIP supplied by Biovantage Labs is strictly for laboratory research purposes. It is not approved for human consumption, veterinary use, or clinical application.

Q: What purity standard does Biovantage Labs apply?

A: Every batch is verified at 99+% purity using HPLC to confirm compound concentration and Mass Spectrometry to confirm molecular identity. Batch-specific COA documentation is available upon request.

Q: Where does Biovantage Labs ship from?

A: All Biovantage Labs products are fulfilled domestically from within Canada, eliminating customs clearance risk and reducing transit time compared to international suppliers.