Description

LL-37 Biovantage Labs Research Peptide

LL-37 is the only known human cathelicidin antimicrobial peptide, studied for its roles in innate immunity, direct antimicrobial activity, wound healing, and immunomodulatory signalling research models. Biovantage Labs supplies LL-37 at 99+% purity, verified by batch-specific HPLC and Mass Spectrometry. Domestically fulfilled from Canada. Not for human consumption. Biovantage Labs provides this compound at 99+% purity, confirmed by batch-specific HPLC and Mass Spectrometry analysis, as a lyophilized compound for use in controlled laboratory settings.

Molecular Profile and Chemical Specifications

Specification	Detail
Molecular Formula	C205H340N60O53S2
Molecular Weight	4,493.3 Da
Sequence	[LL-37, 37 aa] (37 AA)
Purity	≥99+% (HPLC/MS verified)
Physical Form	Lyophilized white powder
CAS Number	154947-66-7

 

Primary Research Mechanisms

Antimicrobial peptide research examining innate immune defence alongside anti-inflammatory mechanisms often includes KPV as a complementary research tool. KPV’s NF-kB inhibitory properties and antimicrobial activity represent a structurally simpler (tripeptide vs. 37-residue) but mechanistically distinct approach to the same dual antimicrobial/anti-inflammatory research questions.

Membrane Disruption and Direct Antimicrobial Activity

LL-37 adopts an amphipathic alpha-helical conformation that inserts into and disrupts bacterial and fungal membranes. Research has examined its minimum inhibitory concentrations against gram-positive, gram-negative, and fungal species in microbiology studies.

TLR Signalling Modulation in Innate Immunity

LL-37 modulates innate immune signalling by suppressing TLR4-mediated LPS recognition, reducing excessive inflammatory responses in sepsis models. It simultaneously activates FPRL1 (formyl peptide receptor-like 1), demonstrating bidirectional immunomodulatory research applications.

Wound Healing and Angiogenesis Research

In wound healing research models, LL-37 stimulates keratinocyte migration, re-epithelialization, and angiogenesis. Studies have examined VEGF pathway interactions as a downstream consequence of LL-37’s wounding response signalling.

For innate immunity research examining multiple arms of the immune response, Thymosin Alpha-1 is studied in adjacent contexts, its TLR2/TLR9 pathway activation and dendritic cell maturation properties representing an adaptive immunity dimension that complements LL-37’s innate antimicrobial and TLR4 modulation research profile.

Reconstitution Protocol

• Reconstitute using sterile bacteriostatic water or 0.9% sodium chloride solution
• Introduce diluent slowly along the interior vial wall do not inject directly onto the lyophilized cake
• Swirl gently until fully dissolved do not shake or vortex
• Allow the vial to equilibrate to room temperature before opening to prevent condensation

Storage and Stability

Storage Condition	State	Estimated Stability
-20°C to -80°C	Lyophilized	24+ months
2°C to 8°C	Lyophilized	12 months
Room temperature (20°C)	Lyophilized	3 months
2°C to 8°C	Reconstituted	7 to 14 days

 

Store in a desiccated environment away from UV exposure. Avoid repeated freeze-thaw cycles, which degrade peptide chain integrity over time.

LL-37 Research FAQ

Q: Why is LL-37 unique among human antimicrobial peptides?

A: LL-37 is the only cathelicidin expressed in humans. While most mammals express multiple cathelicidins, humans produce only this single member of the family. This uniqueness makes LL-37 the sole model for studying human cathelicidin biology, giving it a distinct and non-redundant position in innate immunity research.

Q: Is LL-37 for human use?

A: No. LL-37 supplied by Biovantage Labs is strictly for laboratory research purposes. It is not approved for human consumption, veterinary use, or clinical application.

Q: What purity standard does Biovantage Labs apply?

A: Every batch is verified at 99+% purity using HPLC to confirm compound concentration and Mass Spectrometry to confirm molecular identity. Batch-specific COA documentation is available upon request.

Q: Where does Biovantage Labs ship from?

A: All Biovantage Labs products are fulfilled domestically from within Canada, eliminating customs clearance risk and reducing transit time compared to international suppliers.